ProGP424

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP424
Validation Status Uncharacterized
Organism Information
Organism NameAeromonas hydrophila AH-3 (serotype O34)
Domain Bacteria
Classification Family: Aeromonadaceae
Order: Aeromonadales
Class: Gammaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI) 644
Genome Sequence(s)
GenBank NZ_MTPO01000007.1. 
EMBL DQ860510 
Gene Information
Gene NameflaA
GenBank Gene Sequence EU410314.1
Protein Information
Protein NameFlaA (Polar flagellin)
UniProtKB/SwissProt ID B3TZ62
NCBI RefSeq ACB38409.1
EMBL-CDSACB38409.1
UniProtKB Sequence >tr|B3TZ62|B3TZ62_AERHY Flagellin OS=Aeromonas hydrophila subsp. hydrophila GN=flaA PE=3 SV=1 MGLYINTNVSSLNAQRNLMNTNKSLDTSYTRLASGLRINSAKDDAAGLQISNRLTSQING LDQGNRNANDGISVAQTAEGAMDEITSMLQRMRTLSQQSANGSNNTDDRTALQQEYTQLI TEIDRVAKDTTFGGTNILNGNYFGTFQVGADAGQTITFKLTSAFTLSGIASASKGSATVQ SVATADKYKVTKSATATTTTSVGSITTASAAQLAMANLDFMIKVVDSKRAELGAVQNRFD STIRNQANVSENVSAARSRIRDADFATETANLTKQNILQQAASTILSQANQRPQSALSLL QG
Sequence length 302 AA
Subcellular LocationFlaggellum
Function FlaA is one of the two monomers of polar flagellin which is constitutively expressed.
Glycosylation Status
Glycosylation Type O- (Ser/Thr) linked
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionEnzymatic Digests and Bottom Up Mass Spectrometry Analysis, Electrospray Liquid Chromatography Mass Spectrometry Analysis
Protein Glycosylation- Implication O-Glycosylation is necessary for flagellar biogenesis. Pseudaminic acid biosynthetic genes pseB and pseF homologues, were found to be required for flagellar formation and flagellin expression.
Glycan Information
Glycan Annotation Heptasaccharide
Literature
Year of Identification2012
Year of Identification Month Wise2012.8.10
ReferenceWilhelms M, Fulton KM, Twine SM, Tomás JM, Merino S. (2012) Differential glycosylation of polar and lateral flagellins in Aeromonas hydrophila AH-3. J Biol Chem. 287(33):27851-62. [PMID: 22733809]
AuthorWilhelms M, Fulton KM, Twine SM, Tomás JM, Merino S.
Research GroupDepartment of Microbiology, Faculty of Biology, University of Barcelona, ??Diagonal 645, 08071 Barcelona, ??Spain.
Corresponding Author Merino S.
ContactDepartment of Microbiology, Faculty of Biology, University of Barcelona, ??Diagonal 645, 08071 Barcelona, ??Spain.