ProGP427

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP427
Validation Status Characterized
Organism Information
Organism NameNeisseria meningitidis C311 and MC58
Domain Bacteria
Classification Family: Neisseriaceae
Order: Neisseriales
Class: Betaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI) 491
Genome Sequence(s)
GenBank AE002098.2
EMBL AE002098
Gene Information
Gene NameaniA (NMB_1623)
NCBI Gene ID 904036. 
Protein Information
Protein NameAniA
UniProtKB/SwissProt ID Q9JYE1
NCBI RefSeq WP_002225006.1
EMBL-CDSAAF41975.1.
UniProtKB Sequence >sp|Q9JYE1|ANIA_NEIMB Copper-containing nitrite reductase OS=Neisseria meningitidis serogroup B (strain MC58) GN=aniA PE=3 SV=1 MKRQALAAMIASLFALAACGGEPAAQAPAETPAAAAEAASSAAQTAAETPSGELPVIDAV TTHAPEVPPAIDRDYPAKVRVKMETVEKTMTMEDGVEYRYWTFDGDVPGRMIRVREGDTV EVEFSNNPSSTVPHNVDFHAATGQGGGAAATFTAPGRTSTFSFKALQPGLYIYHCAVAPV GMHIANGMYGLILVEPKEGLPKVDKEFYIVQGDFYTKGKKGAQGLQPFDMDKAVAEQPEY VVFNGHVGAIAGDNALKAKAGETVRMYVGNGGPNLVSSFHVIGEIFDKVYVEGGKLINEN VQSTIVPAGGSAIVEFKVDIPGSYTLVDHSIFRAFNKGALGQLKVEGAENPEIMTQKLSD TAYAGNGAAPAASAPAASAPAASASEKSVY
Sequence length 390 AA
Function Copper-containing nitrite reductase
Glycosylation Status
Glycosylation Type O- (Ser) linked
Experimentally Validated Glycosite(s) in Full Length ProteinS373 and S378
Glycosite(s) Annotated Protein Sequence >sp|Q9JYE1|ANIA_NEIMB Copper-containing nitrite reductase OS=Neisseria meningitidis serogroup B (strain MC58) GN=aniA PE=3 SV=1 MKRQALAAMIASLFALAACGGEPAAQAPAETPAAAAEAASSAAQTAAETPSGELPVIDAV TTHAPEVPPAIDRDYPAKVRVKMETVEKTMTMEDGVEYRYWTFDGDVPGRMIRVREGDTV EVEFSNNPSSTVPHNVDFHAATGQGGGAAATFTAPGRTSTFSFKALQPGLYIYHCAVAPV GMHIANGMYGLILVEPKEGLPKVDKEFYIVQGDFYTKGKKGAQGLQPFDMDKAVAEQPEY VVFNGHVGAIAGDNALKAKAGETVRMYVGNGGPNLVSSFHVIGEIFDKVYVEGGKLINEN VQSTIVPAGGSAIVEFKVDIPGSYTLVDHSIFRAFNKGALGQLKVEGAENPEIMTQKLSD TAYAGNGAAPAAS*(373)APAAS*(378)APAASASEKSVY
Sequence Around Glycosites (21 AA) YAGNGAAPAASAPAASAPAAS
AAPAASAPAASAPAASASEKS
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionMass Spectrometry
Literature
Year of Identification2013
Year of Identification Month Wise2013.05.03
Year of Validation 2013
ReferenceBenjamin L. Schulz, Freda E. C. Jen, Peter M. Power, Christopher E. Jones, Kate L. Fox, Shan C. Ku, Joanne T. Blanchfield, and Michael P. Jennings (2013) Identification of Bacterial Protein O-Oligosaccharyltransferases and Their Glycoprotein Substrates. PLoS One. 2013; 8(5): e62768.
AuthorBenjamin L. Schulz, Freda E. C. Jen, Peter M. Power, Christopher E. Jones, Kate L. Fox, Shan C. Ku, Joanne T. Blanchfield, and Michael P. Jennings
Research GroupSchool of Chemistry and Molecular Biosciences, The University of Queensland, Brisbane, Queensland, Australia.
Corresponding Author Michael P. Jennings
ContactSchool of Chemistry and Molecular Biosciences, The University of Queensland, Brisbane, Queensland, Australia.