ProGP441

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP441
Validation Status Characterized
Organism Information
Organism NamePseudomonas aeruginosa strain UCBPP-PA14
Domain Bacteria
Classification Family: Pseudomonadaceae
Order: Pseudomonadales
Class: Gammaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI) 208963 
Genome Sequence(s)
GenBank NC_008463.1. 
EMBL CP000438 
Gene Information
Gene NamefliC
Protein Information
Protein NameFliC (Type B Flagellin)
UniProtKB/SwissProt ID A0A0H2Z7X1
NCBI RefSeq WP_003082185.1
EMBL-CDSABJ10257.1.
UniProtKB Sequence >tr|A0A0H2Z7X1|A0A0H2Z7X1_PSEAB Flagellin OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=fliC PE=3 SV=1 MALTVNTNIASLNTQRNLNASSNDLNTSLQRLTTGYRINSAKDDAAGLQISNRLSNQISG LNVATRNANDGISLAQTAEGALQQSTNILQRIRDLALQSANGSNSDADRAALQKEVAAQQ AELTRISDTTTFGGRKLLDGSFGTTSFQVGSNAYETIDISLQNASASAIGSYQVGSNGAG TVASVAGTATASGIASGTVNLVGGGQVKNIAIAAGDSAKAIAEKMDGAIPNLSARARTVF TADVSGVTGGSLNFDVTVGSNTVSLAGVTSTQDLADQLNSNSSKLGITASINDKGVLTIT SATGENVKFGAQTGTATAGQVAVKVQGSDGKFEAAAKNVVAAGTAATTTVVTGYVQLNSP TAYSVSGTGTQASQVFGNASAAQKSSVASVDISTADGAQNAIAVVDNALAAIDAQRADLG AVQNRFKNTIDNLTNISENATNARSRIKDTDFAAETAALSKNQVLQQAGTAILAQANQLP QAVLSLLR
Sequence length 484 AA
Glycosylation Status
Glycosylation Type N- (Asn) linked
Experimentally Validated Glycosite(s) in Full Length ProteinN26, N69 and N439
Glycosite(s) Annotated Protein Sequence >tr|A0A0H2Z7X1|A0A0H2Z7X1_PSEAB Flagellin OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=fliC PE=3 SV=1 MALTVNTNIASLNTQRNLNASSNDLN*(26)TSLQRLTTGYRINSAKDDAAGLQISNRLSNQISG LNVATRNAN*(69)DGISLAQTAEGALQQSTNILQRIRDLALQSANGSNSDADRAALQKEVAAQQ AELTRISDTTTFGGRKLLDGSFGTTSFQVGSNAYETIDISLQNASASAIGSYQVGSNGAG TVASVAGTATASGIASGTVNLVGGGQVKNIAIAAGDSAKAIAEKMDGAIPNLSARARTVF TADVSGVTGGSLNFDVTVGSNTVSLAGVTSTQDLADQLNSNSSKLGITASINDKGVLTIT SATGENVKFGAQTGTATAGQVAVKVQGSDGKFEAAAKNVVAAGTAATTTVVTGYVQLNSP TAYSVSGTGTQASQVFGNASAAQKSSVASVDISTADGAQNAIAVVDNALAAIDAQRADLG AVQNRFKNTIDNLTNISEN*(439)ATNARSRIKDTDFAAETAALSKNQVLQQAGTAILAQANQLP QAVLSLLR
Sequence Around Glycosites (21 AA) RNLNASSNDLNTSLQRLTTGY
SGLNVATRNANDGISLAQTAE
TIDNLTNISENATNARSRIKD
Glycosite Sequence Logo
Technique(s) used for Glycosylation Detectionconcanavalin A and wheat germ agglutinin
Technique(s) used for Glycosylated Residue(s) Detection NanoLC MS
Literature
Year of Identification2013
Year of Identification Month Wise2013.1
Year of Validation 2013
ReferenceKhemiri A, Naudin B, Franck X, Song PC, Jouenne T, Cosette P. (2013) N-glycosidase treatment with 18O labeling and de novo sequencing argues for flagellin FliC glycopolymorphism in Pseudomonas aeruginosa. Anal Bioanal Chem. 2013 Dec;405(30):9835-42.
AuthorKhemiri A, Naudin B, Franck X, Song PC, Jouenne T, Cosette P
Research GroupCNRS, UMR 6270, Laboratory "Polymères, Biopolymères, Surfaces", 76820, Mont-Saint-Aignan, France
Corresponding Author Cosette P
ContactCNRS, UMR 6270, Laboratory "Polymères, Biopolymères, Surfaces", 76820, Mont-Saint-Aignan, France