ProGP443

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP443
Validation Status Characterized
Organism Information
Organism NameLactobacillus plantarum
Domain Bacteria
Classification Family: Lactobacillaceae
Order: Lactobacillales
Class: Bacilli (or Firmibacteria)
Division or phylum: "Firmicutes"
Taxonomic ID (NCBI) 220668
Genome Sequence(s)
GenBank NC_004567.2. 
EMBL AL935263
Gene Information
NCBI Gene ID 1062579. 
GenBank Gene Sequence NC_004567.2. 
Protein Information
Protein NameLp_2260
UniProtKB/SwissProt ID F9UQH9
NCBI RefSeq WP_003641538.1.
EMBL-CDSCCC79468.1.
UniProtKB Sequence >tr|F9UQH9|F9UQH9_LACPL Extracellular protein, DUF336 family OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=lp_2260 PE=4 SV=1 MSKKGFLLGVVLGGAAIATAVMKMDDDKKAELKAKAQQGIADFKDRAIDYAFYANDAAED FKAEAGQQFEDTKRKVADFADQYQAAKQETGESFGSSLDQATDSLRSELAKVEDDEGDDE DIVIDGGAAYQKAGEDEKTSAPVPESAPAKDATPAKSDDESTTDESSPAK
Sequence length 170 AA
Subcellular LocationExtracellular
Glycosylation Status
Glycosylation Type O- (Ser) linked
Experimentally Validated Glycosite(s) in Full Length ProteinS146
Glycosite(s) Annotated Protein Sequence >tr|F9UQH9|F9UQH9_LACPL Extracellular protein, DUF336 family OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=lp_2260 PE=4 SV=1 MSKKGFLLGVVLGGAAIATAVMKMDDDKKAELKAKAQQGIADFKDRAIDYAFYANDAAED FKAEAGQQFEDTKRKVADFADQYQAAKQETGESFGSSLDQATDSLRSELAKVEDDEGDDE DIVIDGGAAYQKAGEDEKTS*(146)APVPESAPAKDATPAKSDDESTTDESSPAK
Sequence Around Glycosites (21 AA) DEKTSAPVPESAPAKDATPAK
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionGlycoprotein enrichment with agarose bound WGA
Technique(s) used for Glycosylated Residue(s) Detection LC-MS/MS analysis
Glycan Information
Glycan Annotation Monosaccharide (Double HexNAc, HexNAc)
Literature
Year of Identification2013
Year of Identification Month Wise2013.12.23
ReferenceFredriksen L, Moen A, Adzhubei AA, Mathiesen G, Eijsink VG, Egge-Jacobsen W. (2013) Lactobacillus plantarum WCFS1 O-linked protein glycosylation: an extended spectrum of target proteins and modification sites detected by mass spectrometry. Glycobiology. 2013 Dec;23(12):1439-51. doi: 10.1093/glycob/cwt071. Epub 2013 Sep 1.
AuthorFredriksen L, Moen A, Adzhubei AA, Mathiesen G, Eijsink VG, Egge-Jacobsen W
Research GroupDepartment of Chemistry, Biotechnology and Food Science, Norwegian University of Life Sciences, 1432 Aas, Norway.
Corresponding Author Egge-Jacobsen W
ContactDepartment of Chemistry, Biotechnology and Food Science, Norwegian University of Life Sciences, 1432 Aas, Norway.