ProGP457

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP457
Validation Status Characterized
Organism Information
Organism NameMycobacterium tuberculosis H37Rv
Domain Bacteria
Classification Family: Mycobacteriaceae
Suborder: Corynebacterineae
Order: Actinomycetales
Subclass: Actinobacteridae
Class: Actinobacteria
Division or phylum: "Actinobacteria"
Taxonomic ID (NCBI) 83332
Genome Sequence(s)
GenBank NC_000962.3. 
EMBL CP009480 
Gene Information
Gene NameRv0175
NCBI Gene ID 886801
GenBank Gene Sequence NC_000962.3
Protein Information
Protein NameProbable conserved MCE associated membrane protein
UniProtKB/SwissProt ID O07419
NCBI RefSeq NP_214689.3
EMBL-CDSCCP42901.1.
UniProtKB Sequence >tr|O07419|O07419_MYCTU Probable conserved Mce associated membrane protein OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0175 PE=1 SV=1 MKAADSAESDAGADQTGPQVKAADSAESDAGELGEDACPEQALVERRPSRLRRGWLVGIA ATLLALAGGLGAAGYFALRSHQESQSIAREDLAAIEAAKDCVAATQAPDAGAMSASMQKI IECGTGDFGAQASLYTSMLVEAYQAASVHVQVTDMRAAVERNNNDGSVDVLVALRVKVSN TDSDAHEVGYRLRVRMALDEGRYKIAKLDQVTK
Sequence length 213 AA
Subcellular LocationMembrane
Glycosylation Status
Glycosylation Type O- (Ser) linked
Experimentally Validated Glycosite(s) in Full Length ProteinS114 or S116
Glycosite(s) Annotated Protein Sequence >tr|O07419|O07419_MYCTU Probable conserved Mce associated membrane protein OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0175 PE=1 SV=1 MKAADSAESDAGADQTGPQVKAADSAESDAGELGEDACPEQALVERRPSRLRRGWLVGIA ATLLALAGGLGAAGYFALRSHQESQSIAREDLAAIEAAKDCVAATQAPDAGAMS*(114)AS*(116)QKI IECGTGDFGAQASLYTSMLVEAYQAASVHVQVTDMRAAVERNNNDGSVDVLVALRVKVSN TDSDAHEVGYRLRVRMALDEGRYKIAKLDQVTK
Sequence Around Glycosites (21 AA) ATQAPDAGAMSASMQKIIECG
QAPDAGAMSASMQKIIECGTG
Average Amino Acid Composition around Glycosite(s)_DCVAATQAPDAGAMS(he)ASMQK__DCVAATQAPDAGAMSAS(he)MQK_
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionLC-MS (CID)
Technique(s) used for Glycosylated Residue(s) Detection CID
Glycan Information
Glycan Annotation Hex
Literature
Year of Identification2014
Year of Identification Month Wise2014.1.31
ReferenceSmith, Geoffrey T., Michael J. Sweredoski, and Sonja Hess. "O-linked glycosylation sites profiling in Mycobacterium tuberculosis culture filtrate proteins." Journal of proteomics 97 (2014): 296-306.
AuthorSmith, Geoffrey T., Michael J. Sweredoski, and Sonja Hess.
Research GroupProteome Exploration Laboratory, Beckman Institute, California Institute of Technology, Pasadena, CA, USA
Corresponding Author Sonja Hess.
ContactProteome Exploration Laboratory, Beckman Institute, California Institute of Technology, Pasadena, CA, USA