ProGP459

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP459
Validation Status Characterized
Organism Information
Organism NameMycobacterium tuberculosis H37Rv
Domain Bacteria
Classification Family: Mycobacteriaceae
Suborder: Corynebacterineae
Order: Actinomycetales
Subclass: Actinobacteridae
Class: Actinobacteria
Division or phylum: "Actinobacteria"
Taxonomic ID (NCBI) 83332
Genome Sequence(s)
GenBank NC_000962.3. 
EMBL CP009480 
Gene Information
Gene NameRv2744c
NCBI Gene ID 888304
GenBank Gene Sequence NC_000962.3
Protein Information
Protein Name35kDa protein
UniProtKB/SwissProt ID P9WHP5
NCBI RefSeq YP_177903
EMBL-CDSCCP45543.1.
UniProtKB Sequence >sp|P9WHP5|35KD_MYCTU 35 kDa protein OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2744c PE=1 SV=1 MANPFVKAWKYLMALFSSKIDEHADPKVQIQQAIEEAQRTHQALTQQAAQVIGNQRQLEM RLNRQLADIEKLQVNVRQALTLADQATAAGDAAKATEYNNAAEAFAAQLVTAEQSVEDLK TLHDQALSAAAQAKKAVERNAMVLQQKIAERTKLLSQLEQAKMQEQVSASLRSMSELAAP GNTPSLDEVRDKIERRYANAIGSAELAESSVQGRMLEVEQAGIQMAGHSRLEQIRASMRG EALPAGGTTATPRPATETSGGAIAEQPYGQ
Sequence length 270 AA
Subcellular LocationCytoplasm
Glycosylation Status
Glycosylation Type O- (Thr) linked
Experimentally Validated Glycosite(s) in Full Length ProteinT248, T249 or T251
Glycosite(s) Annotated Protein Sequence >sp|P9WHP5|35KD_MYCTU 35 kDa protein OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2744c PE=1 SV=1 MANPFVKAWKYLMALFSSKIDEHADPKVQIQQAIEEAQRTHQALTQQAAQVIGNQRQLEM RLNRQLADIEKLQVNVRQALTLADQATAAGDAAKATEYNNAAEAFAAQLVTAEQSVEDLK TLHDQALSAAAQAKKAVERNAMVLQQKIAERTKLLSQLEQAKMQEQVSASLRSMSELAAP GNTPSLDEVRDKIERRYANAIGSAELAESSVQGRMLEVEQAGIQMAGHSRLEQIRASMRG EALPAGGT*(248)T*(249)AT*(251)PRPATETSGGAIAEQPYGQ
Sequence Around Glycosites (21 AA) MRGEALPAGGTTATPRPATET
RGEALPAGGTTATPRPATETS
EALPAGGTTATPRPATETSGG
Average Amino Acid Composition around Glycosite(s)_GEALPAGGT(he)TATPR__GEALPAGGTT(he)ATPR_
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionLC-MS
Technique(s) used for Glycosylated Residue(s) Detection ETD
Glycan Information
Glycan Annotation Hex
Literature
Year of Identification2014
Year of Identification Month Wise2014.1.31
ReferenceSmith, Geoffrey T., Michael J. Sweredoski, and Sonja Hess. "O-linked glycosylation sites profiling in Mycobacterium tuberculosis culture filtrate proteins." Journal of proteomics 97 (2014): 296-306.
AuthorSmith, Geoffrey T., Michael J. Sweredoski, and Sonja Hess.
Research GroupProteome Exploration Laboratory, Beckman Institute, California Institute of Technology, Pasadena, CA, USA
Corresponding Author Sonja Hess.
ContactProteome Exploration Laboratory, Beckman Institute, California Institute of Technology, Pasadena, CA, USA