
Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP482
Validation Status Uncharacterized
Organism Information
Organism NameBurkholderia cenocepacia K56-2
Domain Bacteria
Classification Family: Burkholderiaceae
Order: Burkholderiales
Class: Betaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI) 985075
Genome Sequence(s)
GenBank NZ_LAUA01000000
EMBL LAUA01000000
Organism Additional Information Causes opportunistic infections in plants, insects, animals, and humans
Gene Information
Gene Namebcal0786
Protein Information
Protein NamePutative uncharacterized protein
UniProtKB/SwissProt ID B4EAP9
NCBI RefSeq WP_006499026.1
UniProtKB Sequence >tr|B4EAP9|B4EAP9_BURCJ Putative membrane protein OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=BCAL0786 PE=4 SV=1 MISINKEPSRPAGTIGWRARIAAWARGPTLARDIALVLIVKLILLMSLKYAFFNHPQAEH MSLPPAAVAEKLLSVPAPASTEGDHHDK
Sequence length 88 AA
Subcellular LocationInner membrane
Glycosylation Status
Glycosylation Type O- (Ser/Thr) linked
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionZIC-HILIC,immunoblotting,tryptic digestion, and MS/MS analysis
Glycan Information
Glycan Annotation Trisaccharide HexNAc-HexNAc-Hex.
Protein Glycosylation linked (PGL) gene(s)
OST Gene NamePglLBC
Year of Identification2014
Year of Identification Month Wise2014.3.5
ReferenceLithgow KV, Scott NE, Iwashkiw JA, Thomson EL, Foster LJ, Feldman MF, Dennis JJ. (2014) A general protein O-glycosylation system within the Burkholderia cepacia complex is involved in motility and virulence. Mol Microbiol., 92(1):116-37.
AuthorLithgow KV, Scott NE, Iwashkiw JA, Thomson EL, Foster LJ, Feldman MF, Dennis JJ.
Research GroupDepartment of Biological Sciences, University of Alberta, Edmonton, Alberta, Canada,
Corresponding Author Dennis JJ.
ContactDepartment of Biological Sciences, University of Alberta, Edmonton, Alberta, Canada,