ProGP487

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP487
Validation Status Uncharacterized
Organism Information
Organism NameBurkholderia cenocepacia K56-2
Domain Bacteria
Classification Family: Burkholderiaceae
Order: Burkholderiales
Class: Betaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI) 985075
Genome Sequence(s)
GenBank NZ_LAUA01000000
EMBL LAUA01000000
Organism Additional Information Causes opportunistic infections in plants, insects, animals, and humans
Gene Information
Gene Namebcal2398
Protein Information
Protein NamePutative PRC barrel containing lipoprotein
UniProtKB/SwissProt ID B4E6C4
NCBI RefSeq WP_006489610.1
EMBL-CDSCAR52699.1
UniProtKB Sequence >tr|B4E6C4|B4E6C4_BURCJ Putative lipoprotein OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=BCAL2398 PE=4 SV=1 MSGGLPFPASRKSLPSSTVFLILAAAALLSGCGLLPVQNPPAPISEALVESVEETAGEPL TMPPVPAPTQPETPEAPKKPHREVTRSKPVQRPESPTPPPPPPPPIVATRPLDRTQIHAL LDSEVARRNGKVVGRAVDMVVDASGKPREMIVNLQGFMGIGDRKVIFPWNVFRFTPGGKQ EPIVLDVPSGDLPPAARPKAVPLSGSAAASPTTRLPMLDSDVERPNGTKIGRIVDVLIDR GAQPQAVVLDLGGLVNTDRRSIAASWGALRFVTRDKALHPQLDLNDAQIKASPPYAADKP IVAVFPPVVPAAPASSASATR
Sequence length 321 AA
Subcellular LocationInner or outer membrane
Function Putative lipoprotein, Contains an all beta PRC barrel, found in reaction centre of purple photosynthetic bacteria.
Glycosylation Status
Glycosylation Type O- (Ser/Thr) linked
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionZIC-HILIC,immunoblotting,tryptic digestion, and MS/MS analysis
Glycan Information
Glycan Annotation Trisaccharide HexNAc-HexNAc-Hex.
Protein Glycosylation linked (PGL) gene(s)
OST Gene NamePglLBC
OST ProGT IDProGT72
Literature
Year of Identification2014
Year of Identification Month Wise2014.3.5
ReferenceLithgow KV, Scott NE, Iwashkiw JA, Thomson EL, Foster LJ, Feldman MF, Dennis JJ. (2014) A general protein O-glycosylation system within the Burkholderia cepacia complex is involved in motility and virulence. Mol Microbiol., 92(1):116-37.
AuthorLithgow KV, Scott NE, Iwashkiw JA, Thomson EL, Foster LJ, Feldman MF, Dennis JJ.
Research GroupDepartment of Biological Sciences, University of Alberta, Edmonton, Alberta, Canada,
Corresponding Author Dennis JJ.
ContactDepartment of Biological Sciences, University of Alberta, Edmonton, Alberta, Canada,