ProGP501

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP501
Validation Status Uncharacterized
Organism Information
Organism NameAcinetobacter baylyi
Domain Bacteria
Classification Family: Moraxellaceae
Order: Pseudomonadales
Class: Gammaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI) 62977
Genome Sequence(s)
GenBank CR543861
EMBL CR543861
Protein Information
Protein NameUncharacterized protein
UniProtKB/SwissProt ID Q6F8B6
EMBL-CDSCAG69699.1
UniProtKB Sequence >tr|Q6F8B6|Q6F8B6_ACIAD Uncharacterized protein OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=ACIAD2990 PE=4 SV=1 MGSFMRKSSSGNDSESTALGWKFVIIVGIITTIFFTFLYLAMSSEPDYMPNQENQRSASK PNVEASVSSQNATLSASQPQHQ
Sequence length 82 AA
Subcellular LocationMembrane
Glycosylation Status
Glycosylation Type O- (Ser/Thr) linked
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionZIC-HILIC for glycopeptide enrichment, multiple MS/MS fragmentation
Glycan Information
Glycan Annotation Pentasaccharide (HexNAc - HexNAc -HexNAc-HexNAc-HexNAc)
Protein Glycosylation linked (PGL) gene(s)
OST Gene NamePglLADP1
OST ProGT IDProGT83
Literature
Year of Identification2015
Year of Identification Month Wise2015.4.6
ReferenceHarding CM, Nasr MA, Kinsella RL, Scott NE, Foster LJ, Weber BS, Fiester SE, Actis LA, Tracy EN, Munson RS Jr, Feldman MF. (2015) . Acinetobacter strains carry two functional oligoligoligosaccharyltransferases, one devoted exclusively to type IV pilin, and the other one dedicated to O-glycosylation of multiple proteins. Mol Microbiol. 5, 1023-41. [PMID: 25727908]
AuthorHarding CM, Nasr MA, Kinsella RL, Scott NE, Foster LJ, Weber BS, Fiester SE, Actis LA, Tracy EN, Munson RS Jr, Feldman MF.
Research Group1 Center for Microbial Pathogenesis, The Research Institute at Nationwide Childrens Hospital, Columbus, OH, USA. 2 Department of Pediatrics, College of Medicine, The Ohio State University, Columbus, OH, USA. 3 Biomedical Sciences Graduate Program, College of Medicine, The Ohio State University, Columbus, OH, USA. 4 Department of Biological Sciences, University of Alberta, Edmonton, AB, T6G 2G2, Canada. 5 Centre for High-Throughput Biology, University of British Columbia, Vancouver, BC, Canada. 6 Department of Microbiology, Miami University, Oxford, OH, USA
Corresponding Author Feldman MF.
ContactDepartment of Biological Sciences, University of Alberta, Edmonton, AB, T6G 2G2, Canada.