ProGP518

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP518
Validation Status Uncharacterized
Organism Information
Organism NameNeisseria elongata subsp. glycolytica
Domain Bacteria
Classification Family: Neisseriaceae
Order: Neisseriales
Class: Betaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI) 546263
Genome Sequence(s)
GenBank ADBF01000023 
EMBL ADBF01000023 
Gene Information
Gene NamecycB (NEIELOOT_01411)
Protein Information
Protein NameC5
UniProtKB/SwissProt ID D4DQS1
NCBI RefSeq WP_003772008.1
EMBL-CDSAJE18049.1
UniProtKB Sequence >tr|D4DQS1|D4DQS1_NEIEG Cytochrome C OS=Neisseria elongata subsp. glycolytica ATCC 29315 GN=NEIELOOT_01411 PE=4 SV=1 MNHPTNQNARGSALTTLIGGIVILLATLYFLVKLASSGYHGTVEETTDAATQTRIQPQGS IVEGDGVPVGERKGDKIFAKVCYQCHAADSSTAGSPKITHNADWAPRLAQGFDTLFNHAL NGFNAMPAKGGQSDLTELELKRAIVYMANQSGGNLPDPDKAPAPTESAASGAASEAAASG AASAAGKSEAAAPAEGGSGDVMATGKKVFDGLCFGCHGANSAIPDTPRVTHKDEWAPRIN KGKDTLFKHALEGFQDKGMMPAKGGNTELSDDEVKAAVVYMVNESGGKF
Sequence length 289 AA
Subcellular LocationMembrane
Function A c-type diheme cytochrome
Glycosylation Status
Glycosylation Type O- (Ser/Thr) linked
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionDifference in mobility on immunoblots
Glycan Information
Glycan Annotation A tetrasaccharide glycoform consisting of di-N-acetylbacillosamine-glucose-di-N-acetyl hexuronic acid-N-acetylhexosamine (diNAcBac-Glc-diNAcHexA-HexNAc).
Technique(s) used for Glycan Identification Mass spectrometry
Literature
Year of Identification2015
Year of Identification Month Wise2015.10.19
ReferenceAnonsen JH, Vik Å, Børud B, Viburiene R, Aas FE, Kidd SW, Aspholm M, Koomey M (2016) Characterization of a Unique Tetrasaccharide and Distinct Glycoproteome in the O-Linked Protein Glycosylation System of Neisseria elongata subsp. glycolytica. J Bacteriol., 198(2):256-67. [PMID: 26483525]
AuthorAnonsen JH, Vik Å, Børud B, Viburiene R, Aas FE, Kidd SW, Aspholm M, Koomey M
Research GroupDepartment of Biosciences, University of Oslo, Oslo, Norway
Corresponding Author Koomey M
ContactDepartment of Biosciences, University of Oslo, Oslo, Norway