ProGP520

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP520
Validation Status Characterized
Organism Information
Organism NameHaloarcula hispanica strain ATCC 33960
Domain Archaea
Classification Family: Halobacteriaceae
Order: Halobacteriales
Class: Halobacteria
Division or phylum: "Euryarchaeota"
Taxonomic ID (NCBI) 634497
Genome Sequence(s)
GenBank CP002921
EMBL CP002921
Organism Additional Information H. hispanica, a halophilic archaeon, is extraordinary among members of the Halobacteriaceae in that it displays particularly low restriction activity and is therefore important as one of the most tractable haloarchaea for archaeal genetic research. The membrane contains a high content of carotenoid pigments (bacterioruberin) which give red pigmentation to the cells. It needs at least 3.4 M NaCl (higher than that needed by H. volcanii) for good growth.
Gene Information
Gene NameHah_1991
NCBI Gene ID 11050867
GenBank Gene Sequence NC_015948.1
Protein Information
Protein NameSlg1 (S-layer glycoprotein)
UniProtKB/SwissProt ID G0HV85
NCBI RefSeq WP_014040752.1
EMBL-CDSAEM57587.1
UniProtKB Sequence >tr|G0HV85|G0HV85_HALHT Uncharacterized protein OS=Haloarcula hispanica (strain ATCC 33960 / DSM 4426 / JCM 8911 / NBRC 102182 / NCIMB 2187 / VKM B-1755) GN=HAH_1991 PE=4 SV=1 MTDTNEKIRSLFLTALMVFSVFAGTIAFSGGAAAAANVSVQQAAEYDSGTVELALNGSTG STVNTGDIDIYVDGNKNPSNYGVSSVDTTDDGTTGRLQFSLDQDVQPNRNLTVKVSGLTG GDNTVVAEDIDVTSQTIDADDDSGDTNAFRGEVLAIRADGDTDNDDATSSTKIVVEDSNG AVVTQDTYTANSKVYTYETENLDTGEEYEVSVAGDADENITISNLDLNVNIDDDVGDGAN IDDKDTLAVNVSTTRGGEPANATLFNEDDDKVATQVESLKGNENVVFDFGNQSADDSPYY VKVTDNQTGVSAESDQINVSESDDGEASFESSTVQDNIGDVVNITVQVDNTEDAVINIGD ENDDNYYIQGQLEDDNGDGEVTVQFNSYTAGNYSDSTVLSVPGDDDIDNIKEGGDYTRGS LSGDTLEAGSYSMNVTAGTSPDVTSPDTVGTLRLNENSVENIQTWAAPSDADIDDDDVDI YDRIGENLTQSDDVAAEDVVVHEIQASGIEGALEYEQEDGSASDVTEAFIAATDTTPYRI NDSDATTSGLRLYVNRTDVGANADANPIDFSNSSDAVTVVDDPDNNTYFVAVDTSDVVFE NGKTIVKEEDTRLNATFSVREGPLTDDRNSDSAIYTTSERDATLDLDDSGVVTVSAAAGQ EVTGETNVAPGSELEVEMESESDANPFVIRPEVDVATDGTYTATADFQDYSAGTNFTVQT LDVDGDSDFSDEEDGRIVEADTATVSISEQESDGSEVVVDSAQLSEGGFIAIHAGNASGD VVGNSEYLGAGSHEDITVTLDEPMDEDFTAVAMPHQDTNGNEAYDFPGDDDPYTQNGSAV TDSANVTIVEEEQTEAPDTETETEAPDTETEEETDAPATDEPATDESETTAAEGPGFTAA IALIALVAAALLAVRRDN
Sequence length 918 AA
Function The number and similarity of the S-layer glycoproteins may be used as a potential taxonomic marker for halophilic archaea. In addition to this, S-layer glycoproteins might be helpful as reporter molecules for studying the origin and evolution of archaea.
Glycosylation Status
Glycosylation Type N- (Asn) and O- (Ser/Thr) linked
Experimentally Validated Glycosite(s) in Full Length ProteinN306
Glycosite(s) Annotated Protein Sequence >tr|G0HV85|G0HV85_HALHT Uncharacterized protein OS=Haloarcula hispanica (strain ATCC 33960 / DSM 4426 / JCM 8911 / NBRC 102182 / NCIMB 2187 / VKM B-1755) GN=HAH_1991 PE=4 SV=1 MTDTNEKIRSLFLTALMVFSVFAGTIAFSGGAAAAANVSVQQAAEYDSGTVELALNGSTG STVNTGDIDIYVDGNKNPSNYGVSSVDTTDDGTTGRLQFSLDQDVQPNRNLTVKVSGLTG GDNTVVAEDIDVTSQTIDADDDSGDTNAFRGEVLAIRADGDTDNDDATSSTKIVVEDSNG AVVTQDTYTANSKVYTYETENLDTGEEYEVSVAGDADENITISNLDLNVNIDDDVGDGAN IDDKDTLAVNVSTTRGGEPANATLFNEDDDKVATQVESLKGNENVVFDFGNQSADDSPYY VKVTDN*(305)QTGVSAESDQINVSESDDGEASFESSTVQDNIGDVVNITVQVDNTEDAVINIGD ENDDNYYIQGQLEDDNGDGEVTVQFNSYTAGNYSDSTVLSVPGDDDIDNIKEGGDYTRGS LSGDTLEAGSYSMNVTAGTSPDVTSPDTVGTLRLNENSVENIQTWAAPSDADIDDDDVDI YDRIGENLTQSDDVAAEDVVVHEIQASGIEGALEYEQEDGSASDVTEAFIAATDTTPYRI NDSDATTSGLRLYVNRTDVGANADANPIDFSNSSDAVTVVDDPDNNTYFVAVDTSDVVFE NGKTIVKEEDTRLNATFSVREGPLTDDRNSDSAIYTTSERDATLDLDDSGVVTVSAAAGQ EVTGETNVAPGSELEVEMESESDANPFVIRPEVDVATDGTYTATADFQDYSAGTNFTVQT LDVDGDSDFSDEEDGRIVEADTATVSISEQESDGSEVVVDSAQLSEGGFIAIHAGNASGD VVGNSEYLGAGSHEDITVTLDEPMDEDFTAVAMPHQDTNGNEAYDFPGDDDPYTQNGSAV TDSANVTIVEEEQTEAPDTETETEAPDTETEEETDAPATDEPATDESETTAAEGPGFTAA IALIALVAAALLAVRRDN
Sequence Around Glycosites (21 AA) DSPYYVKVTDNQTGVSAESDQ
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionPeriodic acid-Schiff staining, ConA binding and TFMS deglycosylation
Technique(s) used for Glycosylated Residue(s) Detection MALDI-TOF MS and MS/MS
Glycan Information
Glycan Annotation N-glycan was identified as a branched trisaccharide containing a 225 Da residue which corresponds to a 2-amino-6-sulfo-2, 6-dideoxy-quinovose. Glcα-1,4-Gal disaccharide was identified as the O-glycan. Acidic trisaccharides linked to N306.
Technique(s) used for Glycan Identification ESI–MS, MALDI-TOF, MS/MS after aminobenzamide (2-AB) labeling and NMR (DQF-COSY, HSQC, TOCSY and HMBC)
Literature
Year of Identification2015
Year of Identification Month Wise2015.11.1
Year of Validation 2015
ReferenceLu H, Lü Y, Ren J, Wang Z, Wang Q, Luo Y, Han J, Xiang H, Du Y, Jin C. (2015) Identification of the S-layer glycoproteins and their covalently linked glycans in the halophilic archaeon Haloarcula hispanica. Glycobiology, 25(11):1150-62.
AuthorLu H, Lü Y, Ren J, Wang Z, Wang Q, Luo Y, Han J, Xiang H, Du Y, Jin C.
Research Group1 State Key Laboratory of Mycology University of Chinese Academy of Sciences, Beijing 100101, China. 2 State Key Laboratory of Mycology. 3 Educational Ministry Key Laboratory of Resource Biology and Biotechnology in Western China, Life Science College, Northwest University, Xian 710069, China. 4 State Key Laboratory of Microbial Resources, Institute of Microbiology, Chinese Academy of Sciences, Beijing 100101, China. 5 Research Center for Eco-Environmental Sciences, Chinese Academy of Sciences, Beijing 100085, China. 6 State Key Laboratory of Mycology
Corresponding Author Jin C
ContactState Key Laboratory of Mycology