ProGP56

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP56
Validation Status Uncharacterized
Organism Information
Organism NameClostridium thermocellum ATCC 27405
Domain Bacteria
Classification Family: Clostridiaceae
Order: Clostridiales
Class: Clostridia
Division or phylum: "Firmicutes"
Taxonomic ID (NCBI) 203119
Genome Sequence(s)
GenBank CP000568.1
EMBL CP000568
Gene Information
Gene NamecipA (Cthe_3077)
NCBI Gene ID 4809951
GenBank Gene Sequence 4809951
Protein Information
Protein NameCellulolosome complex (Cellulosomal-scaffolding protein A)
UniProtKB/SwissProt ID Q06851
NCBI RefSeq YP_001039466.1
EMBL-CDSABN54273.1
UniProtKB Sequence >sp|Q06851|CIPA_CLOTH Cellulosomal-scaffolding protein A OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237) GN=cipA PE=1 SV=2 MRKVISMLLVVAMLTTIFAAMIPQTVSAATMTVEIGKVTAAVGSKVEIPITLKGVPSKGM ANCDFVLGYDPNVLEVTEVKPGSIIKDPDPSKSFDSAIYPDRKMIVFLFAEDSGRGTYAI TQDGVFATIVATVKSAAAAPITLLEVGAFADNDLVEISTTFVAGGVNLGSSVPTTQPNVP SDGVVVEIGKVTGSVGTTVEIPVYFRGVPSKGIANCDFVFRYDPNVLEIIGIDPGDIIVD PNPTKSFDTAIYPDRKIIVFLFAEDSGTGAYAITKDGVFAKIRATVKSSAPGYITFDEVG GFADNDLVEQKVSFIDGGVNVGNATPTKGATPTNTATPTKSATATPTRPSVPTNTPTNTP ANTPVSGNLKVEFYNSNPSDTTNSINPQFKVTNTGSSAIDLSKLTLRYYYTVDGQKDQTF WCDHAAIIGSNGSYNGITSNVKGTFVKMSSSTNNADTYLEISFTGGTLEPGAHVQIQGRF AKNDWSNYTQSNDYSFKSASQFVEWDQVTAYLNGVLVWGKEPGGSVVPSTQPVTTPPATT KPPATTKPPATTIPPSDDPNAIKIKVDTVNAKPGDTVNIPVRFSGIPSKGIANCDFVYSY DPNVLEIIEIKPGELIVDPNPDKSFDTAVYPDRKIIVFLFAEDSGTGAYAITKDGVFATI VAKVKSGAPNGLSVIKFVEVGGFANNDLVEQRTQFFDGGVNVGDTTVPTTPTTPVTTPTD DSNAVRIKVDTVNAKPGDTVRIPVRFSGIPSKGIANCDFVYSYDPNVLEIIEIEPGDIIV DPNPDKSFDTAVYPDRKIIVFLFAEDSGTGAYAITKDGVFATIVAKVKSGAPNGLSVIKF VEVGGFANNDLVEQKTQFFDGGVNVGDTTEPATPTTPVTTPTTTDDLDAVRIKVDTVNAK PGDTVRIPVRFSGIPSKGIANCDFVYSYDPNVLEIIEIEPGDIIVDPNPDKSFDTAVYPD RKIIVFLFAEDSGTGAYAITKDGVFATIVAKVKSGAPNGLSVIKFVEVGGFANNDLVEQK TQFFDGGVNVGDTTEPATPTTPVTTPTTTDDLDAVRIKVDTVNAKPGDTVRIPVRFSGIP SKGIANCDFVYSYDPNVLEIIEIEPGDIIVDPNPDKSFDTAVYPDRKIIVFLFAEDSGTG AYAITKDGVFATIVAKVKEGAPNGLSVIKFVEVGGFANNDLVEQKTQFFDGGVNVGDTTE PATPTTPVTTPTTTDDLDAVRIKVDTVNAKPGDTVRIPVRFSGIPSKGIANCDFVYSYDP NVLEIIEIEPGELIVDPNPTKSFDTAVYPDRKMIVFLFAEDSGTGAYAITEDGVFATIVA KVKSGAPNGLSVIKFVEVGGFANNDLVEQKTQFFDGGVNVGDTTEPATPTTPVTTPTTTD DLDAVRIKVDTVNAKPGDTVRIPVRFSGIPSKGIANCDFVYSYDPNVLEIIEIEPGDIIV DPNPDKSFDTAVYPDRKIIVFLFAEDSGTGAYAITKDGVFATIVAKVKEGAPNGLSVIKF VEVGGFANNDLVEQKTQFFDGGVNVGDTTVPTTSPTTTPPEPTITPNKLTLKIGRAEGRP GDTVEIPVNLYGVPQKGIASGDFVVSYDPNVLEIIEIEPGELIVDPNPTKSFDTAVYPDR KMIVFLFAEDSGTGAYAITEDGVFATIVAKVKEGAPEGFSAIEISEFGAFADNDLVEVET DLINGGVLVTNKPVIEGYKVSGYILPDFSFDATVAPLVKAGFKVEIVGTELYAVTDANGY FEITGVPANASGYTLKISRATYLDRVIANVVVTGDTSVSTSQAPIMMWVGDIVKDNSINL LDVAEVIRCFNATKGSANYVEELDINRNGAINMQDIMIVHKHFGATSSDYDAQ
Sequence length 1853 AA
Subcellular LocationSecreted (Cell surface)
Function Cellulose-binding, multicellulase-containing protein complex, termed the cellulosome, which displays endo-glucanase and glucohydrolase activity and mediates strong adherence of the bacterium to the insoluble substrate. Also called cellulose-interacting protein A.
Glycosylation Status
Glycosylation Type O- (Thr) linked
Glycosite Sequence Logo
Glycan Information
Glycan Annotation Linkage: Gal→Thr. Gal as the major component, Glc, GlcNAc, and an unknown monosaccharide residue were detected. The total carbohydrate content was 6.8% (w/w). Tetrasaccharide is a component of the S1 subunit of the cellulosome (from SDS-PAGE experiments).
BCSDB ID123549, 123550, 123551, 123552, 123553, 135527, 135528, 136865, 136867, 136868, 136869, 136870, 136871
Literature
Year of Identification1989
Year of Identification Month Wise1989.12
ReferenceBayer EA, Shoham Y, Lamed R (2000) The Cellulosome. An Extracellular Organelle for Degrading Plant Cell Wall Polysaccharides. In: Doyle RJ (ed) Glycomicrobiology.
AuthorBayer EA , Shoham Y , Lamed R
Research Group1 Department of Biological Chemistry, The Weizmann Institute of Science, Rehovot 76100 Israel 2 Department of Food Engineering and Biotechnology, Technion – Israel Institute of Technology, Haifa 32000 Israel 3 Department of Molecular Microbiology and Biotechnology, George S. Wise Faculty of Life Sciences, Tel Aviv University, Ramat Aviv 69978 Israel
Corresponding Author Lamed R
ContactDepartment of Molecular Microbiology and Biotechnology, George S. Wise Faculty of Life Sciences, Tel Aviv University, Ramat Aviv 69978 Israel