ProGP72

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP72
Validation Status Uncharacterized
Organism Information
Organism NameHaloarcula marismortui
Domain Archaea
Classification Family: Halobacteriaceae
Order: Halobacteriales
Class: Halobacteria or Halomebacteria
Division or phylum: "Euryarchaeota"
Taxonomic ID (NCBI) 2238
Genome Sequence(s)
GenBank AY596297.1
EMBL AY596297
Gene Information
Gene NamephoD (rrnAC0273)
NCBI Gene ID 3129569
Protein Information
Protein NameAlkaline Phosphatase D
UniProtKB/SwissProt ID Q5V573
NCBI RefSeq YP_135035.1
EMBL-CDSAAV45329.1
UniProtKB Sequence >tr|Q5V573|Q5V573_HALMA Alkaline phosphatase D OS=Haloarcula marismortui GN=phoD PE=4 SV=1 MRPTDLPEIDTTAQNRRTFMQRTGGVSLAAVLGLSKGASAMVDDDGNFESDPYTLGIASG DPLPDSVIIWTRLAPNPLEADGAMPSETFSVEWTVATDEGMSDIVNTGTATAEPDHAHTI HVDADGLEPATEYYYQFACRGETSPIGRTKTAPAAGASVDAFQFGFASCNRWVDGHYTAF GQMAEDELDLIVHLGDYIYEYGIDVSESPREKSLPQEYKKETTDLDTYRLRYGLYKSDPN LRAAHASAPWLVTRDDHEVDNNWAGNVPQDPDKQSTEAFIQRRAAALKAYYEHLPFRMEQ KPDDASQKLYRYYEFGDLLDFNVLDTRLYRSDQACDDVFNKVDCAERFEEDRTILGDAQE EWLLENLSATETTWNVLANQLPFATMDFKQGPEEGFRTEQWDGYVPEQNLVKTAFEEDAN NPVVITGDFHSHWANTLISAKDGSSEPVGAEFVGTSISSGGNGTDMDDFGRYVVTENDNV EYYNNQRGYVRCTVTPDNWTTEFQVLEYVDEPGAPMRTDATVELTAGQPGIPDDNPLILA DSIAVGNGKNGTAELTGRWLETGLSGAAMTVTISDPEIATITGVSVADPFSISETDVASD GASADIRFADVEKNAQSVVGGTDTRLATLDIRGQSAGTADIEVSVERLDDDSGTALVANT ELGVIIVGPPPVTGSDEPTDPDGDGHFEDVNGNGRVDYDDIQLLFDNFDDDSVALNKTAY DFNENGKLEYDDIVTLYSEVN
Sequence length 741 AA
Subcellular LocationSecreted
Function Extracellular Ca2+-dependent inducible alkaline phosphatase.
Glycosylation Status
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionDetermination of sugar content by modified ferric cyanide method; in vivo labeling with radioactive glucosamine.
Literature
Year of Identification1990
Year of Identification Month Wise1990.12
ReferenceGoldman, S., Hecht, K., Eisenberg, H. and Mevarech, M. (1990) Extracellular Ca2(+)-dependent inducible alkaline phosphatase from extremely halophilic archaebacterium Haloarcula marismortui. J Bacteriol, 172, 7065-7070. [PubMed: 2123861]
Author Mevarech, M.
Research GroupDepartment of Polymer Research, Weizmann Institute of Science, Rehovot, Israel.
Corresponding Author Goldman, S., Hecht, K., Eisenberg, H. Mevarech, M.
ContactDepartment of Polymer Research, Weizmann Institute of Science, Rehovot, Israel.