ProGP83

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP83
Validation Status Uncharacterized
Organism Information
Organism NamePseudomonas syringae strain S203
Domain Bacteria
Classification Family: Pseudomonadaceae
Order: Pseudomonadales
Class: Gammaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI) 321
Genome Sequence(s)
GenBank X03035
EMBL X03035
Organism Additional Information Pseudomonas syringae (Gram-negative bacterium) is phytopathogenic.
Gene Information
Gene NameinaZ
Protein Information
Protein NameIce nucleation lipoglycoprotein
UniProtKB/SwissProt ID P06620
EMBL-CDSCAA26837.1
UniProtKB Sequence >sp|P06620|ICEN_PSESY Ice nucleation protein OS=Pseudomonas syringae pv. syringae GN=inaZ PE=1 SV=1 MNLDKALVLRTCANNMADHCGLIWPASGTVESRYWQSTRRHENGLVGLLWGAGTSAFLSV HADARWIVCEVAVADIISLEEPGMVKFPRAEVVHVGDRISASHFISARQADPASTSTSTL TPMPTAIPTPMPAVASVTLPVAEQARHEVFDVASVSAAAAPVNTLPVTTPQNVQTATYGS TLSGDNHSRLIAGYGSNETAGNHSDLIAGYGSTGTAGSDSWLVAGYGSTQTAGGDSALTA GYGSTQTAREGSNLTAGYGSTGTAGSDSSLIAGYGSTQTSGGDSSLTAGYGSTQTAQEGS NLTAGYGSTGTAGSDSSLIAGYGSTQTSGGDSSLTAGYGSTQTAQEGSNLTAGYGSTGTA GVDSSLIAGYGSTQTSGSDSALTAGYGSTQTAQEGSNLTAGYGSTGTAGSDSSLIAGYGS TQTSGSDSSLTAGYGSTQTAQEGSILTAGYGSTGTAGVDSSLIAGYGSTQTSGSDSALTA GYGSTQTAQEGSNLTAGYGSTGTAGADSSLIAGYGSTQTSGSESSLTAGYGSTQTAREGS TLTAGYGSTGTAGADSSLIAGYGSTQTSGSESSLTAGYGSTQTAQQGSVLTSGYGSTQTA GAASNLTTGYGSTGTAGHESFIIAGYGSTQTAGHKSILTAGYGSTQTARDGSDLIAGYGS TGTAGSGSSLIAGYGSTQTASYRSMLTAGYGSTQTAREHSDLVTGYGSTSTAGSNSSLIA GYGSTQTAGFKSILTAGYGSTQTAQERTSLVAGYGSTSTAGYSSSLIAGYGSTQTAGYES TLTAGYGSTQTAQENSSLTTGYGSTSTAGYSSSLIAGYGSTQTAGYESTLTAGYGSTQTA QERSDLVTGYGSTSTAGYASSLIAGYGSTQTAGYESTLTAGYGSTQTAQENSSLTTGYGS TSTAGFASSLISGYGSTQTAGYKSTLTAGYGSTQTAEYGSSLTAGYGSTATAGQDSSLIA GYGSSLTSGIRSFLTAGYGSTLIAGLRSVLIAGYGSSLTSGVRSTLTAGYGSNQIASYGS SLIAGHESIQVAGNKSMLIAGKGSSQTAGFRSTLIAGAGSVQLAGDRSRLIAGADSNQTA GDRSKLLAGNNSYLTAGDRSKLTGGHDCTLMAGDQSRLTAGKNSVLTAGARSKLIGSEGS TLSAGEDSILIFRLWDGKRYRQLVARTGENGVEADIPYYVNEDDDIVDKPDEDDDWIEVK
Sequence length 1200 AA
Subcellular LocationOuter membrane
Function It helps in nucleating ice formation in supercooled water.
Protein Structure
PDB ID 1INA, 1INB
Glycosylation Status
Glycosylation Type N- (Asn) and O- (Ser/Thr) linked
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionEnzyme treatment, deglycosylation (O- and N- glycans).
Glycan Information
Glycan Annotation Linkages: Man-N-Asn, Gal-O-Ser, Gal-O-Thr.
Literature
Year of Identification1991
Year of Identification Month Wise1991.11
ReferenceKozloff, L.M., Turner, M.A. and Arellano, F. (1991) Formation of bacterial membrane ice-nucleating lipoglycoprotein complexes. J Bacteriol, 173, 6528-6536. [PubMed: 1917877]
Author Arellano, F.
Research GroupDepartment of Microbiology, University of California, San Francisco 
Corresponding Author Kozloff, L.M., Turner, M.A. Arellano, F.
ReferenceTurner, M.A., Arellano, F. and Kozloff, L.M. (1991) Components of ice nucleation structures of bacteria. J Bacteriol, 173, 6515-6527. [PubMed: 1917876]
AuthorTurner MA, Arellano F, Kozloff LM
Research GroupDepartment of Microbiology, University of California, San Francisco 94143-0404.
Corresponding Author Kozloff LM
ContactDepartment of Microbiology, University of California, San Francisco 94143-0404.