ProGP84

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP84
Validation Status Uncharacterized
Organism Information
Organism NameChloroflexus aurantiacus
Domain Bacteria
Classification Family: Chloroflexaceae
Order: Chloroflexales
Class: Chloroflexi
Division or phylum: "Chloroflexi"
Taxonomic ID (NCBI) 324602
Genome Sequence(s)
GenBank U78046.1
EMBL U78046
Gene Information
Gene NameCaur_1950
NCBI Gene ID 5826401
Protein Information
Protein NameAuracyanin-B1 (22 kDa)
UniProtKB/SwissProt ID P27197
NCBI RefSeq YP_001635554.1
EMBL-CDSAAB38318.1
UniProtKB Sequence >sp|P27197|AURB_CHLAA Auracyanin-B OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=Caur_1950 PE=1 SV=2 MSWRGSGRSNFRSRSSSNGGSTFSGGSAGGPPLIVMMGLAFGAGLIMLIVMIASNATAGG FVAATPRPTATPRPTAAPAPTQPPAAQPTTAPATQAANAPGGSNVVNETPAQTVEVRAAP DALAFAQTSLSLPANTVVRLDFVNQNNLGVQHNWVLVNGGDDVAAAVNTAAQNNADALFV PPPDTPNALAWTAMLNAGESGSVTFRTPAPGTYLYICTFPGHYLAGMKGTLTVTP
Sequence length 235 AA (signal and pro-peptide 80 AA)
Subcellular LocationMembrane associated (peripheral)
Function Blue copper protein. It is involved in photosynthetic electron transfer in the anoxygenic photosynthetic bacterium. Can donate electrons to cytochrome c-554. It has an intense absorption band near 600 nm in the oxidized form. Contains a type 1 copper(II) ion characterized by an intense blue color.
Protein Structure
PDB ID 1OV8, 1QHQ
Glycosylation Status
Glycosylation Type N- (Asn) and O- (Ser/Thr) linked
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionThymol sulfuric acid-staining
Glycan Information
Glycan Annotation Linkages: Glc-N-Asn, Glc-O-Ser/Thr. Contains 9.4 ± 0.3% (w/w) sugar.
Literature
Year of Identification1992
Year of Identification Month Wise1992.4
ReferenceMcManus, J.D., Brune, D.C., Han, J., Sanders-Loehr, J., Meyer, T.E., Cusanovich, M.A., Tollin, G. and Blankenship, R.E. (1992) Isolation, characterization, and amino acid sequences of auracyanins, blue copper proteins from the green photosynthetic bacterium Chloroflexus aurantiacus. J Biol Chem, 267, 6531-6540. [PubMed: 1313011]
AuthorSanders-Loehr, J., Meyer, T.E., Cusanovich, M.A., Tollin, G.
Research GroupDepartment of Chemistry and Biochemistry, Arizona State University, Tempe
Corresponding Author McManus, J.D., Brune, D.C., Han, J., S ers-Loehr, J., Meyer, T.E., Cusanovich, M.A., Tollin, G.
ContactDepartment of Chemistry and Biochemistry, Arizona State University, Tempe