ProGP552 (Hypothetical protein but identical to entrocin96 of Enterococcus faecalis WHE96)
Home -> ProGPdb -> Search ProGP -> Display data
| ProGP ID | ProGP552 (Hypothetical protein but identical to entrocin96 of Enterococcus faecalis WHE96) |
| Validation Status | Characterized |
| Organism Information | |
| Organism Name | Enterococcus faecalis TX0104 |
| Domain | Bacteria |
| Classification | Phylum : Firmicutes Class : Bacilli Orders : Lactobacillales Family : Enterococcaceae Genus : Enterococcus Species : faecalis Strain : TX0104 |
| Taxonomic ID (NCBI) | 491074 |
| Genome Information | |
| GenBank | GG668924.1 |
| EMBL | GG668924.1 |
| Gene Information | |
| Gene Name | HMPREF0348_0422 |
| GenBank Gene Sequence | ACGL01000031.1 |
| Protein Information | |
| Protein Name | Hypothetical protein but identical to entrocin96 of Enterococcus faecalis WHE96 |
| UniProtKB/SwissProt ID | UPI00019C73D0 |
| NCBI RefSeq | WP_002382828 |
| UniProtKB Sequence | >UPI00019C73D0 status=active MERTKGDNTMLNKKLLENGVVNAVTIDELDAQFGGMSKRDCNLMKACCAGQAVTYAIHSL LNRLGGDSSDPAGCNDIVRKYCK |
| Sequence length | 83 AA |
| Glycosylation Status | |
| Glycosylation Type | O- (Ser) and S- (Cys) linked |
| Experimentally Validated Glycosite(s) in Full Length Protein | S33 (C33 when S33 replaced with C33) |
| Glycosite(s) Annotated Protein Sequence | >tr|C0X1N7|C0X1N7_ENTFL Uncharacterized protein OS=Enterococcus faecalis TX0104 GN=HMPREF0348_0422 PE=4 SV=1 MERTKGDNTMLNKKLLENGVVNAVTIDELDAQFGGMSKRDCNLMKACCAGQAVTYAIHSLLNRLGGDS*(33)SDPAGCNDIVRKYCK |
| Sequence Around Glycosites (21 AA) | HSLLNRLGGDSSDPAGCNDIV |
| Technique(s) used for Glycosylated Residue(s) Detection | LC ESI-MS, MALDI-TOF MS and tandem MS |
| Protein Glycosylation- Implication | It is a di-glycosylated bacteriocin and active in glucosylated form only. Its antimicrobial activity affected by both nature and number of sugars attached to EC peptide affect its bioactivity against Listeria species. |
| Glycan Information | |
| Glycan Annotation | single and double glucosylated ( glucose and galactose) |
| Protein Glycosylation linked (PGL) gene(s) | |
| OST Gene Name | EntS |
| OST ProGT ID | ProGT116 |
| Literature | |
| Year of Identification | 2017 |
| Year of Identification Month Wise | 2017.05.25 |
| Year of Validation | 2017 |
| Reference | Nagar, R. and Rao, A., 2017. An iterative glycosyltransferase EntS catalyzes transfer and extension of O-and S-linked monosaccharide in enterocin 96. Glycobiology, 27(8), pp.766-776. |
| Corresponding Author | Alka Rao |
| Contact | CSIR-Institute of Microbial Technology, Sector 39A, Chandigarh 160036, India |