ProGT149.1 (GtrA)

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGT149.1 (GtrA)
Organism Information
Organism NameCytophaaga hutchinsonii
Domain Bacteria
Classification Phylum : Bacteroidetes
Class : Bacteroidata
Orders : Cytophagales
Family : Cytophagacaea
Genus : Cytophaga
Species : hutchinsonii
Taxonomic ID (NCBI)985
Genome Information
Gene BankNC_008255
Gene Information
Gene NameCHU_0012 
Protein information
Protein NameGtrA 
UniProtKB/ SwissProt IDA0A6N4SR17
NCBI Ref Seq WP_011583422.1
UniProtKB Sequence>tr|A0A6N4SR17|A0A6N4SR17_CYTH3 GtrA domain-containing protein OS=Cytophaga hutchinsonii (strain ATCC 33406 / DSM 1761 / CIP 103989 / NBRC 15051 / NCIMB 9469 / D465) OX=269798 GN=CHU_1534 PE=4 SV=1 MIIGTVSTVFFNLAIHHFISLAHGFNHGQINKDILLIIGTVSTVFLNLAIHHSSHRPMVL TVGK
Sequence length64AA
Litrature
Year Of Validation2022 
Reference Xie, S., Huang, Q., Tan, R., Zhang, W., Qi, Q. and Lu, X., 2022. Glycosyltransferase-Related Protein GtrA Is Essential for Localization of Type IX Secretion System Cargo Protein Cellulase Cel9A and Affects Cellulose Degradation in Cytophaga hutchinsonii. Applied and Environmental Microbiology, 88(20), pp.e01076-22.

Corresponding AuthorState Key Laboratory of Microbial Technology, Shandong University, Qingdao, China