| Organism Information |
| Organism Name | Neisseria meningitidis MC58 |
| Clinical Implication | Pathogenic |
| Domain | Bacteria |
| Phylum | Proteobacteria |
| Classification | Family: Neisseriaceae
Order: Neisseriales
Class: Betaproteobacteria
Division or phylum: "Proteobacteria" |
| Taxonomic ID (NCBI) | 122586 |
| Genome Information |
| Gene Bank | AE002098 |
| EMBL | AE002098 |
| Gene Information |
| Gene Name | pglL |
| NCBI Gene ID | 902711 |
| NCBI Reference Sequence | AEK98518.1 |
| Protein information |
| Protein Name | PglL |
| UniProtKB/ SwissProt ID | G1FG65 |
| NCBI Ref Seq | WP_002244038.1 |
| UniProtKB Sequence | >tr|G1FG65|G1FG65_NEIME Oligosaccharyltransferase OS=Neisseria meningitidis GN=pglL PE=4 SV=1
MPAETTVSGAHPAAKLPIYILPCFLWIGIVPFTFALKLKPSPDFYHDAAAAAGLIVLLFL
TAGKKLFDVKIPAISFLLFAMAAFWYLQARLMNLIYPGMNDIVSWIFILLAVSAWACRSL
VAHFGQERIVTLFAWSLLIGSLLQSCIVVIQFAGWEDTPLFQNIIVYSGQGVIGHIGQRN
NLGHYLMWGILAAAYLNGQRKIPAALGVICLIMQTAVLGLVNSRTILTYIAAIALILPFW
YFRSDKSNRRTMLGIAAAVFLTALFQFSMNTILETFTGIRYETAVERVANGGFTDLPRQI
EWNKALAAFQSAPIFGHGWNSFAQQTFLINAEQHNIYDNLLSNLFTHSHNIVLQLLAEMG
ISGTLLVAATLLTGIAGLLKRPLTPASLFLICTLAVSMCHSMLEYPLWYVYFLIPFGLML
FLSPAEASDGIAFKKAANLGILTASAAIFAGLLHLDWTYTRLVNAFSPATDDSAKTLNRK
INELRYISANSPMLSFYADFSLVNFALPEYPETQTWAEEATLKSLKYRPHSATYRIALYL
MRQGKVAEAKQWMRATQSYYPYLMPRYADEIRKLPVWAPLLPELLKDCKAFAAAPGHPEA
KPCK
|
| EMBL CDS | AEK98518.1 |
| Sequence length | 604 AA |
| Subcellular Location | Membrane (Integral component of membrane) |
| Function in Native Organism | 1) PglL is OSTase transfer the trisaccharide to the pili protein. |
| Potential Application | 1) PgIL has relaxed specificity and can transfer the variety of glycans on acceptor substrate, this non-specific behavior of enzyme can use to design conjugate vaccines. |
| Additional Information | 1) PglL has relaxed specificity towards donor sugar and able to transfer oligo- and polysaccharides to pilin. |
| Glycosyltransferase Information |
| Glycosylation Type | O- (Ser/Thr) linked |
| EC Number (BRENDA) | 2.4.1.119 |
| Mechanism of Glycan Transfer | En bloc |
| Donor Type | Lipid linked sugars |
| Donor Specificity | UndPP-Trisaccharide |
| Accessory GT ID | ProGT25.1 ProGT25.2 ProGT25.3 ProGT25.4 ProGT25.5 |
| Glycan Information |
| Glycan transferred | Trisaccharide (Gal(beta 1-4)Gal(alpha 1-3)2,4-diacetimido-2,4,6-trideoxyhexose). |
| Method of Glycan Indentification | Nano LC-ESI-MS and MS/MS |
| Experimental_strategies | In vivo |
| Acceptor Subtrate Information |
| Acceptor Substrate name | PilE |
| ProGPdb ID | ProGP99 |
| Litrature |
| Year Of Validation | 2007 |
| Reference | Faridmoayer, A., Fentabil, M. A., Mills, D. C., Klassen, J. S., & Feldman, M. F. (2007). Functional characterization of bacterial oligosaccharyltransferases involved in O-linked protein glycosylation. Journal of bacteriology, 189(22), 8088-8098.
|
| Authors | Faridmoayer, A., Fentabil, M. A., Mills, D. C., Klassen, J. S., & Feldman, M. F.
|
| Research groups | Alberta Ingenuity Centre for Carbohydrate Science, Canada
|
| Corresponding Author | Feldman, M. F.
|
| Contacts | Alberta Ingenuity Centre for Carbohydrate Science, Canada
|
| Reference | Faridmoayer, A., Fentabil, M. A., Haurat, M. F., Yi, W., Woodward, R., Wang, P. G., & Feldman, M. F. (2008). Extreme substrate promiscuity of the Neisseria oligosaccharyl transferase involved in protein O-glycosylation. Journal of Biological Chemistry, 283(50), 34596-34604.
|
| Authors | Faridmoayer, A., Fentabil, M. A., Haurat, M. F., Yi, W., Woodward, R., Wang, P. G., & Feldman, M. F.
|
| Research groups | Alberta Ingenuity Centre for Carbohydrate Science, Canada
|
| Corresponding Author | Feldman, M. F.
|
| Contacts | Alberta Ingenuity Centre for Carbohydrate Science, Canada
|
| Reference | Faridmoayer, A., Fentabil, M. A., Haurat, M. F., Yi, W., Woodward, R., Wang, P. G., & Feldman, M. F. (2008). Extreme substrate promiscuity of the Neisseria oligosaccharyl transferase involved in protein O-glycosylation. Journal of Biological Chemistry, 283(50), 34596-34604.
|
| Authors | Faridmoayer, A., Fentabil, M. A., Haurat, M. F., Yi, W., Woodward, R., Wang, P. G., & Feldman, M. F.
|
| Research groups | Alberta Ingenuity Centre for Carbohydrate Science, Canada
|
| Corresponding Author | Feldman, M. F.
|
| Contacts | Department of Biological Sciences, Duquesne University, Pittsburgh, PA 15282, USA.
|
